product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-Haptoglobin Antibody
catalog :
PB9219
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse
application :
western blot, immunohistochemistry - paraffin section
product information
Product Name :
Anti-Haptoglobin Antibody
Catalog Number :
PB9219
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Haptoglobin(HP) detection. Tested with WB, IHC-P in Human;Mouse.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human
Notes :
WB: The detection limit for Haptoglobin is approximately 0.2ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human Haptoglobin(128-160aa NNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
Haptoglobin(HP), is a protein that in humans is encoded by the HP gene. Haptoglobin, a plasma glycoprotein that binds free hemoglobin, has a tetrameric structure of 2 alpha and 2 beta polypeptides that are covalently associated by disulfide bonds. Haptoglobin is homologous to serine proteases of the chymotrypsinogen family. A major function of haptoglobin is to bind hemoglobin(Hb) to form a stable Hp-Hb complex and thereby prevent Hb-induced oxidative tissue damage. Haptoglobin is an unusual secretory protein in that it is proteolytically processed in the endoplasmic reticulum and not in the Golgi. In clinical settings, the haptoglobulin assay is used to screen for and monitor intravascular hemolytic anemia.
Reference :
1. Asakawa, J., Kodaira, M., Nakamura, N., Satoh, C., Fujita, M. Chimerism in humans after intragenic recombination at the haptoglobin locus during early embryogenesis. Proc. Nat. Acad. Sci. 96: 10314-10319, 1999. 2. Bensi, G., Raugei, G., Klefenz, H., Cortese, R. Structure and expression of the human haptoglobin locus. EMBO J. 4: 119-126, 1985. 3. Bloom, G. E., Gerald, P. S., Reisman, L. E. Ring D chromosome: a second case associated with anomalous haptoglobin inheritance. Science 156: 1746-1748, 1967.
Gene Name :
HP
Protein Name :
Haptoglobin
Gene Full Name :
haptoglobin
Synonyms :
Binding peptide antibody Bp antibody Haptoglobin alpha chain antibody Haptoglobin alpha(1S) beta antibody Haptoglobin alpha(2FS) beta antibody Haptoglobin beta chain antibody Haptoglobin, alpha polypeptide antibody Haptoglobin, beta polypeptide antibody HP antibody Hp2 alpha antibody HP2 ALPHA2 antibody HP2ALPHA2 antibody HPA1S antibody HPT antibody HPT_HUMAN antibody MGC111141 antibody Zonulin antibody
Uniprot ID :
P00738
company information
Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits