Boster Immunoleader

antibody

Anti-Haptoglobin Antibody

PB9219

100 ug/vial

240 USD

polyclonal

rabbit

human, mouse

western blot, immunohistochemistry - paraffin section

Anti-Haptoglobin Antibody

PB9219

Polyclonal

Rabbit IgG polyclonal antibody for Haptoglobin(HP) detection. Tested with WB, IHC-P in Human;Mouse.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: human, mouse

WB,IHC-P

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse

Concentration: 0.5-1μg/ml; Tested Species: Human

WB: The detection limit for Haptoglobin is approximately 0.2ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence in the middle region of human Haptoglobin(128-160aa NNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Haptoglobin(HP), is a protein that in humans is encoded by the HP gene. Haptoglobin, a plasma glycoprotein that binds free hemoglobin, has a tetrameric structure of 2 alpha and 2 beta polypeptides that are covalently associated by disulfide bonds. Haptoglobin is homologous to serine proteases of the chymotrypsinogen family. A major function of haptoglobin is to bind hemoglobin(Hb) to form a stable Hp-Hb complex and thereby prevent Hb-induced oxidative tissue damage. Haptoglobin is an unusual secretory protein in that it is proteolytically processed in the endoplasmic reticulum and not in the Golgi. In clinical settings, the haptoglobulin assay is used to screen for and monitor intravascular hemolytic anemia.

1. Asakawa, J., Kodaira, M., Nakamura, N., Satoh, C., Fujita, M. Chimerism in humans after intragenic recombination at the haptoglobin locus during early embryogenesis. Proc. Nat. Acad. Sci. 96: 10314-10319, 1999. 2. Bensi, G., Raugei, G., Klefenz, H., Cortese, R. Structure and expression of the human haptoglobin locus. EMBO J. 4: 119-126, 1985. 3. Bloom, G. E., Gerald, P. S., Reisman, L. E. Ring D chromosome: a second case associated with anomalous haptoglobin inheritance. Science 156: 1746-1748, 1967.

HP

Haptoglobin

haptoglobin

Binding peptide antibody Bp antibody Haptoglobin alpha chain antibody Haptoglobin alpha(1S) beta antibody Haptoglobin alpha(2FS) beta antibody Haptoglobin beta chain antibody Haptoglobin, alpha polypeptide antibody Haptoglobin, beta polypeptide antibody HP antibody Hp2 alpha antibody HP2 ALPHA2 antibody HP2ALPHA2 antibody HPA1S antibody HPT antibody HPT_HUMAN antibody MGC111141 antibody Zonulin antibody

P00738