Anti-Fyn Antibody | Boster Immunoleader PB9197 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-Fyn Antibody

catalog :

PB9197

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-Fyn Antibody

Catalog Number :

PB9197

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Tyrosine-protein kinase Fyn(FYN) detection. Tested with WB in Human.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human

Notes :

WB: The detection limit for Fyn is approximately 0.25ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human Fyn(222-255aa ETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTD), identical to the related mouse and rat sequences.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

Proto-oncogene tyrosine-protein kinase Fyn, also known as SYN or SLK, is an enzyme that in humans is encoded by the FYN gene. It is mapped to 6q21. This gene is a member of the protein-tyrosine kinase oncogene family. FYN is a protein, present in the signaling pathway of integrins, which activates ras. It is primarily localized to the cytoplasmic leaflet of the plasma membrane, where it phosphorylates tyrosine residues on key targets involved in a variety of different signaling pathways. Tyrosine phosphorylation of target proteins by FYN serves to either regulate target protein activity, and/or to generate a binding site on the target protein that recruits other signaling molecules.

Reference :

1. Semba K, Nishizawa M, Miyajima N, Yoshida MC, Sukegawa J, Yamanashi Y, Sasaki M, Yamamoto T, Toyoshima K (August 1986). "yes-related protooncogene, syn, belongs to the protein-tyrosine kinase family". Proceedings of the National Academy of Sciences of the United States of America 83 (15): 5459–63. 2. "Entrez Gene: FYN FYN oncogene related to SRC, FGR, YES" 3. Resh MD (November 1998). "Fyn, a Src family tyrosine kinase". The international journal of biochemistry & cell biology 30 (11): 1159–62.

Gene Name :

FYN

Protein Name :

Tyrosine-protein kinase Fyn

Gene Full Name :

FYN proto-oncogene, Src family tyrosine kinase

Synonyms :

C syn protooncogene antibody Fyn antibody FYN oncogene related to SRC FGR YES antibody FYN_HUMAN antibody MGC45350 antibody OKT3 induced calcium influx regulator antibody P59 FYN antibody p59-Fyn antibody Protein tyrosine kinase fyn antibody Proto oncogene tyrosine protein kinase fyn antibody Proto-oncogene c-Fyn antibody Proto-oncogene Syn antibody Protooncogene Syn antibody SLK antibody Src like kinase antibody Src yes related novel gene antibody Src-like kinase antibody Src/yes related novel antibody Src/yes related novel gene antibody SYN antibody Tyrosine kinase p59fyn T antibody Tyrosine kinase p59fyn(T) antibody Tyrosine-protein kinase Fyn antibody

Uniprot ID :

P06241

more info or order :

Boster Immunoleader product webpage