product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-RUNX2 Antibody
catalog :
PB9158
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot
product information
Product Name :
Anti-RUNX2 Antibody
Catalog Number :
PB9158
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
Notes :
WB: The detection limit for RUNX2 is approximately 0.25ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.
Reference :
1. Bergwitz, C.; Prochnau, A.; Mayr, B.; Kramer, F.-J.; Rittierodt, M.; Berten, H.-L.; Hausamen, J.-E.; Brabant, G. : Identification of novel CBFA1/RUNX2 mutations causing cleidocranial dysplasia. J. Inherit. Metab. Dis. 24: 648-656, 2001. 2. D'Souza, R. N.; Aberg, T.; Gaikwad, J.; Cavender, A.; Owen, M.; Karsenty, G.; Thesleff, I. : Cbfa1 is required for epithelial-mesenchymal interactions regulating tooth development in mice. Development 126: 2911-2920, 1999.
Gene Name :
RUNX2
Protein Name :
Runt-related transcription factor 2
Gene Full Name :
runt-related transcription factor 2
Synonyms :
Acute myeloid leukemia 3 protein antibody Alpha subunit 1 antibody AML3 antibody CBF alpha 1 antibody CBF-alpha-1 antibody CBFA1 antibody CCD antibody CCD1 antibody Cleidocranial dysplasia 1 antibody Core binding factor antibody Core binding factor runt domain alpha subunit 1 antibody Core binding factor subunit alpha 1 antibody Core-binding factor subunit alpha-1 antibody MGC120022 antibody MGC120023 antibody Oncogene AML 3 antibody Oncogene AML-3 antibody OSF 2 antibody OSF-2 antibody OSF2 antibody Osteoblast specific transcription factor 2 antibody Osteoblast-specific transcription factor 2 antibody OTTHUMP00000016533 antibody PEA2 alpha A antibody PEA2-alpha A antibody PEA2aA antibody PEBP2 alpha A antibody PEBP2-alpha A antibody PEBP2A1 antibody PEBP2A2 antibody PEBP2aA antibody PEBP2aA antibody PEBP2aA1 antibody Polyomavirus enhancer binding protein 2 alpha A subunit antibody Polyomavirus enhancer-binding protein 2 alpha A subunit antibody Runt domain antibody Runt related transcription factor 2 antibody Runt-related transcription factor 2 antibody RUNX2 antibody RUNX2_HUMAN antibody SL3 3 enhancer factor 1 alpha A subunit antibody SL3-3 enhancer factor 1 alpha A subunit antibody SL3/AKV core binding factor alpha A subunit antibody SL3/AKV core-binding factor alpha A subunit antibody
Uniprot ID :
Q13950
company information
Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits