product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-Bmi1 Antibody
catalog :
PB9133
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot
product information
Product Name :
Anti-Bmi1 Antibody
Catalog Number :
PB9133
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Polycomb complex protein BMI-1(BMI1) detection. Tested with WB in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
Notes :
WB: The detection limit for Bmi1 is approximately 0.25ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
BMI1(BMI1 polycomb ring finger oncogene), also known as RNF51, is a protein which in humans is encoded by the BMI1 gene. The Bmi1 gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain. By fluorescence in situ hybridization, the human BMI1 gene is assigned to chromosome 10p13. BMI1 has a key role in regulating the proliferative activity of normal stem and progenitor cells. Most importantly, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, leading to transplant failure of the leukemia. Complementation studies showed that BMI1 completely rescues these proliferative defects. Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16(INK4). BMI1 selectively extended the life span of these cultures. Confocal microscopy showed that BMI1 transiently colocalized with centromeres during interphase in HeLa cells.
Reference :
1. Alkema, M. J., van der Lugt, N. M. T., Bobeldijk, R. C., Berns, A., van Lohuizen, M. Transformation of axial skeleton due to overexpression of bmi-1 in transgenic mice. Nature 374: 724-727, 1995. 2. Chagraoui, J., Niessen, S. L., Lessard, J., Girard, S., Coulombe, P., Sauvageau, M., Meloche, S., Sauvageau, G. E4F1: a novel candidate factor for mediating BMI1 function in primitive hematopoietic cells. Genes Dev. 20: 2110-2120, 2006. 3. Leung, C., Lingbeek, M., Shakhova, O., Liu, J., Tanger, E., Saremaslani, P., van Lohuizen, M., Marino, S. Bmi1 is essential for cerebellar development and is overexpressed in human medulloblastomas. Nature 428: 337-341, 2004.
Gene Name :
BMI1
Protein Name :
Polycomb complex protein BMI-1
Gene Full Name :
BMI1 proto-oncogene, polycomb ring finger
Synonyms :
B lymphoma Mo MLV insertion region (mouse) antibody B lymphoma Mo MLV insertion region 1 homolog antibody Bmi 1 antibody BMI1 antibody BMI1 polycomb ring finger oncogene antibody BMI1_HUMAN antibody Flvi 2/bmi 1 antibody FLVI2/BMI1 antibody MGC12685 antibody Murine leukemia viral (bmi 1) oncogene homolog antibody Oncogene BMI 1 antibody PCGF 4 antibody PCGF4 antibody Polycomb complex protein BMI 1 antibody Polycomb complex protein BMI-1 antibody Polycomb group protein Bmi1 antibody Polycomb group ring finger 4 antibody Polycomb group RING finger protein 4 antibody RING finger protein 51 antibody RNF 51 antibody RNF51 antibody
Uniprot ID :
P35226
company information
Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits