Boster Immunoleader

antibody

Anti-ACTH Antibody

PB9039

100 ug/vial

240 USD

polyclonal

rabbit

Anti-ACTH Antibody

PB9039

Polyclonal

Rabbit IgG polyclonal antibody for Pro-opiomelanocortin(POMC) detection. Tested with IHC-P in Human;Mouse;Rat.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: mouse, rat Predicted to work with: human

IHC-P

Concentration: 0.5-1μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by SA1022 in IHC(P).

Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.

1. Dibner, Charna; Schibler, Ueli; Albrecht, Urs (2010). "The Mammalian Circadian Timing System: Organization and Coordination of Central and Peripheral Clocks". Annual Review of Physiology72: 517–549. 2. Hanukoglu I, Feuchtwanger R, Hanukoglu A (November 1990). "Mechanism of corticotropin and cAMP induction of mitochondrial cytochrome P450 system enzymes in adrenal cortex cells". J. Biol. Chem. 265 (33): 20602–8. 3. Raikhinstein M, Zohar M, Hanukoglu I (February 1994). "cDNA cloning and sequence analysis of the bovine adrenocorticotropic hormone (ACTH) receptor". Biochim. Biophys. Acta 1220 (3): 329–32.

POMC

Pro-opiomelanocortin

proopiomelanocortin

ACTH antibody Adrenocorticotropic hormone antibody Adrenocorticotropin antibody Adrenocorticotropin Hormone antibody Alpha Melanocyte Stimulating Hormone antibody alpha-MSH antibody alphaMSH antibody Beta Endorphin antibody Beta Lipotropin antibody Beta LPH antibody Beta Melanocyte Stimulating Hormone antibody Beta-endorphin antibody beta-MSH antibody CLIP antibody Corticotropin antibody Corticotropin Like Intermediary Peptide antibody Corticotropin lipotropin antibody Corticotropin lipotropin precursor antibody Corticotropin-like intermediary peptide antibody Gamma LPH antibody gamma-MSH antibody Lipotropin Beta antibody Lipotropin Gamma antibody Lipotropin, included antibody LPH antibody Melanocyte-stimulating hormone, included antibody Melanotropin Alpha antibody Melanotropin beta antibody Melanotropin gamma antibody Melanotropin, included antibody Met Enkephalin antibody Met-enkephalin antibody MSH antibody NPP antibody Opiomelanocortin prepropeptide antibody POC antibody POMC antibody Pomc-1 antibody Pomc1 antibody Pomc2 antibody Pro ACTH endorphin antibody Pro opiomelanocortin antibody Pro-opiomelanocortin-alpha antibody Proopiomelanocortin antibody Proopiomelanocortin preproprotein antibody Tetracosactide antibody

P01189