product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-HIF-2-alpha Antibody
catalog :
PA1129-1
quantity :
100 ug/vial
price :
200 USD
clonality :
polyclonal
host :
rabbit
reactivity :
rat
application :
western blot, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-HIF-2-alpha Antibody
Catalog Number :
PA1129-1
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Endothelial PAS domain-containing protein 1(EPAS1) detection. Tested with WB, IHC-P in Rat.
Price :
200 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: rat
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Rat
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Rat
Notes :
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at N-terminus of rat HIF-2-alpha(202-240aa YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD).
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
HIF-2 alpha is also designated EPAS1 whose gene is mapped to 2p21-p16. The predicted mouse protein is 88% identical to human EPAS1. The human EPAS1 gene contains 15 exons and spans at least 120 kb. The positions of the introns within the genomic region encoding the N-terminal bHLH-PAS domains of EPAS1 and AHR are similar, suggesting that the 5-prime ends of the 2 genes may have arisen from a gene duplication event1. Moreover, the predicted protein shares 48% sequence identity with HIF1-alpha, a bHLH-PAS transcription factor that induces EPO gene expression in cultured cells in response to hypoxia. Like HIF1A, EPAS1 binds to and activates transcription from the HIF1A response element derived from the 3-prime flanking region of the EPO gene. EPAS1 is predominantly expressed in highly vascularized tissues of adult humans and in endothelial cells of the mouse adult and embryo. Furthermore, EPAS1 may represent an important regulator of vascularization, perhaps involving the regulation of endothelial cell gene expression in response to hypoxia2. HIF2A is expressed at relatively higher levels in villus sections of placenta and in lung samples compared with other tissues examined3. In addition, The variation in EPAS1 influences the relative contribution of aerobic and anaerobic metabolism and hence the maximum sustainable metabolic power for a given event duration4.
Reference :
1. Tian, H.; McKnight, S. L.; Russell, D. W. : Endothelial PAS domain protein 1 (EPAS1), a transcription factor selectively expressed in endothelial cells. Genes Dev. 11: 72-82, 1997.
2. Sood, R.; Zehnder, J. L.; Druzin, M. L.; Brown, P. O. : Gene expression patterns in human placenta. Proc. Nat. Acad. Sci. 103: 5478-5483, 2006.
3. Henderson, J.; Withford-Cave, J. M.; Duffy, D. L.; Cole, S. J.; Sawyer, N. A.; Gulbin, J. P.; Hahn, A.; Trent, R. J.; Yu, B. : The EPAS1 gene influences the aerobic-anaerobic contribution in elite endurance athletes. Hum. Genet. 118: 416-423, 2005.
Gene Name :
EPAS1
Protein Name :
Endothelial PAS domain-containing protein 1(EPAS-1)
Gene Full Name :
endothelial PAS domain protein 1
Synonyms :
Basic helix loop helix PAS protein MOP2 antibody Basic-helix-loop-helix-PAS protein MOP2 antibody bHLHe73 antibody Class E basic helix-loop-helix protein 73 antibody ECYT4 antibody Endothelial PAS domain containing protein 1 antibody Endothelial pas domain protein 1 antibody Endothelial PAS domain-containing protein 1 antibody EPAS 1 antibody EPAS-1 antibody EPAS1 antibody EPAS1_HUMAN antibody HIF 1 alpha like factor antibody HIF 2 alpha antibody HIF-1-alpha-like factor antibody HIF-2-alpha antibody HIF2-alpha antibody Hif2a antibody HLF antibody Hypoxia inducible factor 2 alpha antibody Hypoxia inducible factor 2 alpha subunit antibody Hypoxia-inducible factor 2-alpha antibody Member of PAS protein 2 antibody Member of pas superfamily 2 antibody MOP 2 antibody MOP2 antibody PAS domain-containing protein 2 antibody PASD2 antibody
Uniprot ID :
Q9JHS1
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments