product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-CD18 Antibody
catalog :
PA1124
quantity :
100 ug/vial
price :
200 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-CD18 Antibody
Catalog Number :
PA1124
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Integrin beta-2(ITGB2) detection. Tested with WB, IHC-P in Human.
Price :
200 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human
Notes :
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human CD18(24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD), different from the related mouse sequence by five amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the “inside-out” signaling pathways.
Reference :
1. Taylor, G. M.; Williams, A.; D'Souza, S. W.; Fergusson, W. D.; Donnai, D.; Fennell, J.; Harris, R. : The expression of CD18 is increased on trisomy 21 (Down syndrome) lymphoblastoid cells. Clin. Exp. Immun. 71: 324-328, 1988.
2. Weitzman, J. B.; Wells, C. E.; Wright, A. H.; Clark, P. A.; Law, S. K. A. : The gene organisation of the human beta-2 integrin subunit (CD18). FEBS Lett. 294: 97-103, 1991.
3. McDowall, A.; Inwald, D.; Leitinger, B.; Jones, A.; Liesner, R.; Klein, N.; Hogg, N. : A novel form of integrin dysfunction involving beta-1, beta-2, and beta-3 integrins. J. Clin. Invest. 111: 51-60, 2003.
Gene Name :
ITGB2
Protein Name :
Integrin beta-2
Gene Full Name :
integrin, beta 2(complement component 3 receptor 3 and 4 subunit)
Synonyms :
95 subunit beta antibody CD 18 antibody CD18 antibody Cell surface adhesion glycoprotein LFA 1/CR3/P150,959 beta subunit precursor) antibody Cell surface adhesion glycoproteins LFA 1/CR3/p150,95 subunit beta antibody Cell surface adhesion glycoproteins LFA-1/CR3/p150 antibody Complement receptor C3 beta subunit antibody Complement receptor C3 subunit beta antibody Integrin beta 2 antibody Integrin beta chain beta 2 antibody Integrin beta-2 antibody Integrin, beta 2(complement component 3 receptor 3 and 4 subunit) antibody ITB2_HUMAN antibody ITGB2 antibody LAD antibody LCAMB antibody Leukocyte associated antigens CD18/11A, CD18/11B, CD18/11C antibody Leukocyte cell adhesion molecule CD18 antibody LFA 1 antibody LFA1 antibody Lymphocyte function associated antigen 1 antibody MAC 1 antibody MAC1 antibody MF17 antibody MFI7 antibody OTTHUMP00000115278 antibody OTTHUMP00000115279 antibody OTTHUMP00000115280 antibody OTTHUMP00000115281 antibody OTTHUMP00000115282 antibody
Uniprot ID :
P05107
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments