This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Biosensis
product type :
antibody
product name :
Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum
catalog :
GP-029-50
quantity :
50 µl
clonality :
polyclonal
host :
guinea-pigs
conjugate :
nonconjugated
reactivity :
human, rat
application :
immunohistochemistry, immunohistochemistry - frozen section
product information
Catalog Number :
GP-029-50
Product Name :
Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum
Host Species :
Guinea pig
Clonality :
Polyclonal
Product Type :
Whole Serum
Size :
50 µl
Product Description :
AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.
CrossReactivity :
This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
ALTnames :
Agrp; Agrt; Art; Agouti-related protein;
Immunogen :
corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
(SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR
KLGTATNLCSRT)
A synthetic peptide
Specificity :
Specificity was demonstrated by immunohistochemistry.
Packaging :
Small box at room temperature
Application Summary :
IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Storage :
It is recommended that a thawed sample is stored at 4ºC for no longer than 2 weeks. Allocation of appropriate anti-bacterial agent can increase shelf life by several weeks. Diluted serum should be prepared as required. Long term stability requires storage, preferably in small aliquots at -20ºC or lower. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.
products id :
267
company information
Biosensis
39 Winwood Street, Thebarton, South Australia, 5031
info@biosensis.com
http://www.biosensis.com
61 8 83527711
headquarters: Australia
Biosensis specializes in antibodies, proteins, ELISA kits and Staining kits for Neuroscience, with particular emphasis on neurotrophins and neurotrophin receptors for which Biosensis has been the worldwide leader and OEM supplier for nearly 30 years. In addition to neurotrophins, our neuroscience portfolio includes products for research in neurodegenerative diseases, neurodevelopment, and neuro-metabolism. Areas of focus include Alzheimer's, Parkinson's and ALS diseases, as well as autophagy and metabolic and stress disorders including metabolic syndrome research, obesity, and neuroimmunology and inflammation.