product summary
Loading...
company name :
Bio-Rad
other brands :
Biogenesis, Serotec, AbD Serotec, Oxford Biotechnology
product type :
other
product name :
HuCAL Fab-A-FSx2 Negative Control
catalog :
HCA107
quantity :
0.1 mg
price :
264 USD
more info or order :
product information
Entity Type :
Negative/Isotype Control
Entity Category :
Antibodies
ProductCode :
HCA107
Description :
HuCAL Fab-A-FSx2 Negative Control
Specificity :
HuCAL Fab-A-FSx2 Negative Control
TargetSpecies :
Negative Control
Host :
Human
Format :
Purified
Isotypes :
HuCAL Fab bivalent
Applications :
E
ApplicationTypes :
ELISA
Clone :
AbD08972
Quantity :
0.1 mg
Quantity Value :
0.1
Quantity Type :
mg
Entity Formats :
Purified
UNSPSC :
41116161
Concentration :
Antibody concentration 0.5 mg/ml
Product Form :
A bivalent human recombinant Fab (lambda light chain) selected from the HuCAL GOLD phage display library. Expressed in E. coli. This Fab fragment is bivalent by dimerization of the bacterial alkaline phosphatase fusion protein. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
PriceGBP :
189
PriceEUR :
264
PriceUSD :
264 USD
PriceCHF :
287
PriceSEK :
2878
PriceNOK :
2892
PriceDKK :
1968
more info or order :
company information

Bio-Rad
Endeavour House, Langford Business Park
Langford Lane, Kidlington
OXON, OX5 1GE
Langford Lane, Kidlington
OXON, OX5 1GE
antibody_sales_uk@bio-rad.com
https://www.bio-rad-antibodies.com1 800 265 7376 (North America)
44 (0)1865 852 700 (Rest of World)
44 (0)1865 852 700 (Rest of World)
headquarters: UK
Bio-Rad is one of the world's leading antibody manufacturers, offering over 12,000 antibodies and related reagents for a focused range of research areas such as immunology, cancer, veterinary research and cell biology through its antibody experts formerly known as AbD Serotec.
The range includes apoptosis kits, autophagy reagents, CD markers, epitope tag antibodies, immunology antibodies, neuroscience antibodies, and veterinary reagents.
Bio-Rad has an ISO 9001 and ISO 13485 certified production facility in the United Kingdom as well as ISO 9001 certified facilities in Germany and the United States.
Our expertise extends to traditional and recombinant antibody generation and production services. Our custom generation service delivers antibodies in as little as 8 weeks with greater than 90% success. The in vitro technology enables selection of antibodies to challenging targets, long term consistent supply, and provision of the antibody sequence.
At Bio-Rad we are committed to your success when using our antibodies and we focus on providing the technology, products and all the supporting information you need to excel in your research.
The range includes apoptosis kits, autophagy reagents, CD markers, epitope tag antibodies, immunology antibodies, neuroscience antibodies, and veterinary reagents.
Bio-Rad has an ISO 9001 and ISO 13485 certified production facility in the United Kingdom as well as ISO 9001 certified facilities in Germany and the United States.
Our expertise extends to traditional and recombinant antibody generation and production services. Our custom generation service delivers antibodies in as little as 8 weeks with greater than 90% success. The in vitro technology enables selection of antibodies to challenging targets, long term consistent supply, and provision of the antibody sequence.
At Bio-Rad we are committed to your success when using our antibodies and we focus on providing the technology, products and all the supporting information you need to excel in your research.
