NFATC3 antibody - N-terminal region (P100975_P050) | Aviva Systems Biology P100975 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

NFATC3 antibody - N-terminal region (P100975_P050)

catalog :

P100975

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

P100975

product type :

Polyclonal Antibody

category :

Polyclonal

name :

NFATC3 antibody - N-terminal region (P100975_P050)

size :

100 ul

gene symbol :

NFATC3

alias symbols :

NFAT4, NFATX

nucleotide accession num :

NM_004555

protein accession num :

NP_004546

swissprot id :

B5B2S0

species reactivity :

Cow, Dog, Horse, Human, Mouse, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQ
GSLSPARETSI
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

NFATC3 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. NFATC3 plays a role in the regulation of gene expression in T cells and immature thymocytes.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Four transcript variants encoding distinct isoforms have been identified for this gene.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 92%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC3

drywet surcharge :

Wet Ice

storage temperature :

-20C