HTR3A antibody - N-terminal region (AVARP13046_P050) | Aviva Systems Biology AVARP13046 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

HTR3A antibody - N-terminal region (AVARP13046_P050)

catalog :

AVARP13046

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

AVARP13046

product type :

Polyclonal Antibody

category :

Ion Channel

name :

HTR3A antibody - N-terminal region (AVARP13046_P050)

size :

100 ul

gene symbol :

HTR3A

alias symbols :

HTR3, 5HT3R, 5-HT-3, 5-HT3A, 5-HT3R

nucleotide accession num :

NM_000869

protein accession num :

NP_000860

swissprot id :

P46098

species reactivity :

Cow, Dog, Horse, Human, Mouse, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVR
PVRDWRKPTTV
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

HTR3A belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 78%; Dog: 78%; Horse: 91%; Human: 100%; Mouse: 78%; Rat: 78%

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3A

drywet surcharge :

Wet Ice

storage temperature :

-20C