CHRNA9 antibody - N-terminal region (AVARP13019_P050) | Aviva Systems Biology AVARP13019 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

CHRNA9 antibody - N-terminal region (AVARP13019_P050)

catalog :

AVARP13019

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, dogs, bovine, zebrafish

application :

western blot

product information

sku :

AVARP13019

product type :

Polyclonal Antibody

category :

Polyclonal

name :

CHRNA9 antibody - N-terminal region (AVARP13019_P050)

size :

100 ul

gene symbol :

CHRNA9

alias symbols :

NACHRA9, HSA243342

nucleotide accession num :

NM_017581

protein accession num :

NP_060051

swissprot id :

Q9UGM1

species reactivity :

Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLF
EDYSNALRPVE
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

CHRNA9 is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor superfamily. CHRNA9 is a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. It is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea.This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 93%; Rabbit: 100%; Zebrafish: 80%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA9

drywet surcharge :

Wet Ice

storage temperature :

-20C