PDCD4 antibody - N-terminal region (AVARP09045_P050) | Aviva Systems Biology AVARP09045 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

PDCD4 antibody - N-terminal region (AVARP09045_P050)

catalog :

AVARP09045

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

AVARP09045

product type :

Polyclonal Antibody

category :

Polyclonal

name :

PDCD4 antibody - N-terminal region (AVARP09045_P050)

size :

100 ul

gene symbol :

PDCD4

alias symbols :

H731, MGC33046, MGC33047

nucleotide accession num :

NM_145341

protein accession num :

NP_663314

swissprot id :

Q53EL6

species reactivity :

Cow, Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

MTKYPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSI
NEARINAKAKR
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

PDCD4 is a protein localized to the nucleus in proliferating cells. Expression of its gene is modulated by cytokines in natural killer and T cells. PDCD4 is thought to play a role in apoptosis but the specific role has not yet been determined.This gene encodes a protein localized to the nucleus in proliferating cells. Expression of this gene is modulated by cytokines in natural killer and T cells. The gene product is thought to play a role in apoptosis but the specific role has not yet been determined. Two transcripts encoding different isoforms have been identified.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human PDCD4

drywet surcharge :

Wet Ice

storage temperature :

-20C