TNFSF10 antibody - N-terminal region (AVARP02040_P050) | Aviva Systems Biology AVARP02040 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

TNFSF10 antibody - N-terminal region (AVARP02040_P050)

catalog :

AVARP02040

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, dogs

application :

western blot

product information

sku :

AVARP02040

product type :

Polyclonal Antibody

category :

Polyclonal

name :

TNFSF10 antibody - N-terminal region (AVARP02040_P050)

size :

100 ul

gene symbol :

TNFSF10

alias symbols :

TL2, APO2L, CD253, TRAIL, Apo-2L

nucleotide accession num :

NM_003810

protein accession num :

NP_003801

swissprot id :

P50591

species reactivity :

Dog, Human, Pig

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILR
TSEETISTVQE
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

TNFSF1 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF1A/TRAILR1, TNFRSF1B/TRAILR2, TNFRSF1C/TRAILR3, TNFRSF1D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF1C/TRAILR3, TNFRSF1D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3.

host :

Rabbit

application :

homology :

Dog: 80%; Human: 100%; Pig: 78%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF10

drywet surcharge :

Wet Ice

storage temperature :

-20C