CASP3 antibody - N-terminal region (AVARP00021_T100) | Aviva Systems Biology AVARP00021 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

CASP3 antibody - N-terminal region (AVARP00021_T100)

catalog :

AVARP00021

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

AVARP00021

product type :

Polyclonal Antibody

category :

Polyclonal

name :

CASP3 antibody - N-terminal region (AVARP00021_T100)

size :

100 ul

gene symbol :

CASP3

alias symbols :

CPP32, SCA-1, CPP32B

nucleotide accession num :

NM_004346

protein accession num :

NP_004337

swissprot id :

P42574

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKM
DYPEMGLCIII
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 1. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 84%; Dog: 84%; Guinea Pig: 84%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 84%; Rat: 84%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human CASP3

drywet surcharge :

Wet Ice

storage temperature :

-20C