KRT15 antibody - C-terminal region (AVARP00005_P050) | Aviva Systems Biology AVARP00005 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

KRT15 antibody - C-terminal region (AVARP00005_P050)

catalog :

AVARP00005

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, bovine

application :

western blot, immunohistochemistry

product information

sku :

AVARP00005

product type :

Polyclonal Antibody

category :

Polyclonal

name :

KRT15 antibody - C-terminal region (AVARP00005_P050)

size :

100 ul

gene symbol :

KRT15

alias symbols :

CK15, K15, K1CO

nucleotide accession num :

NM_002275

protein accession num :

NP_002266

swissprot id :

P19012

species reactivity :

Cow, Human, Mouse

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVD
GQVVSSHKREI
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

The protein encoded by KRT15 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 86%; Human: 100%; Mouse: 86%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human KRT15

drywet surcharge :

Wet Ice

storage temperature :

-20C