IGF1R antibody - middle region (AVARP00004_P050) | Aviva Systems Biology AVARP00004 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

IGF1R antibody - middle region (AVARP00004_P050)

catalog :

AVARP00004

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot, immunohistochemistry, immunocytochemistry

product information

sku :

AVARP00004

product type :

Polyclonal Antibody

category :

Polyclonal

name :

IGF1R antibody - middle region (AVARP00004_P050)

size :

100 ul

gene symbol :

IGF1R

alias symbols :

CD221, IGFIR, JTK13, MGC142170, MGC142172, MGC18216, IGFR

nucleotide accession num :

NM_000875

protein accession num :

NP_000866

swissprot id :

P08069

species reactivity :

Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNE
RALPLPQSSTC
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival.This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-14 DR729.1 566-75 141-3559 X4434.1 136-3554 356-454 BC11361.1 3542-4522 4541-4921 DA486252.1 187-567 4922-5392 BX9345.1 248-718 5393-5768 CN414655.1 317-692 5769-6158 BM264223.1 185-574 6159-658 BQ185364.1 187-68 6581-11242 AC6929.9 21278-25939 c

host :

Rabbit

application :

IHC, IF, WB

homology :

Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100%

purification :

Affinity Purified

clonality :

Polyclonal

specificity :

Directed to the beta chain of IGF1R

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human IGF1R

drywet surcharge :

Wet Ice

storage temperature :

-20C