This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
IGF1R antibody - middle region (AVARP00004_P050)
catalog :
AVARP00004
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine, zebrafish
application :
western blot, immunohistochemistry, immunocytochemistry
product information
sku :
AVARP00004
product type :
Polyclonal Antibody
category :
Polyclonal
name :
IGF1R antibody - middle region (AVARP00004_P050)
size :
100 ul
gene symbol :
IGF1R
alias symbols :
CD221, IGFIR, JTK13, MGC142170, MGC142172, MGC18216, IGFR
nucleotide accession num :
NM_000875
protein accession num :
NP_000866
swissprot id :
P08069
species reactivity :
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNE
RALPLPQSSTC
Synthetic peptide located within the following region:
RALPLPQSSTC
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival.This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-14 DR729.1 566-75 141-3559 X4434.1 136-3554 356-454 BC11361.1 3542-4522 4541-4921 DA486252.1 187-567 4922-5392 BX9345.1 248-718 5393-5768 CN414655.1 317-692 5769-6158 BM264223.1 185-574 6159-658 BQ185364.1 187-68 6581-11242 AC6929.9 21278-25939 c
host :
Rabbit
application :
IHC, IF, WB
homology :
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100%
purification :
Affinity Purified
clonality :
Polyclonal
specificity :
Directed to the beta chain of IGF1R
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human IGF1R
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments