YTHDF2 Antibody - C-terminal region (ARP67917_P050) | Aviva Systems Biology ARP67917 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

YTHDF2 Antibody - C-terminal region (ARP67917_P050)

catalog :

ARP67917

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP67917

product type :

Polyclonal Antibody

category :

Polyclonal

name :

YTHDF2 Antibody - C-terminal region (ARP67917_P050)

size :

100 ul

gene symbol :

YTHDF2

alias symbols :

HGRG8, NY-REN-2

nucleotide accession num :

NM_016258

protein accession num :

NP_057342

swissprot id :

Q9Y5A9

species reactivity :

Cow, Dog, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

QEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEE
SVKKERQGRGK
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

This gene encodes a member of the YTH (YT521-B homology) superfamily containing YTH domain. The YTH domain is typical for the eukaryotes and is particularly abundant in plants. The YTH domain is usually located in the middle of the protein sequence and may function in binding to RNA. In addition to a YTH domain, this protein has a proline rich region which may be involved in signal transduction. An Alu-rich domain has been identified in one of the introns of this gene, which is thought to be associated with human longevity. In addition, reciprocal translocations between this gene and the Runx1 (AML1) gene on chromosme 21 has been observed in patients with acute myeloid leukemia. This gene was initially mapped to chromosome 14, which was later turned out to be a pseudogene.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C-terminal region of Human YTHDF2

drywet surcharge :

Wet Ice

storage temperature :

-20C