This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
RPL15 antibody - N-terminal region (ARP65141_P050)
catalog :
ARP65141
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine, zebrafish
application :
western blot
product information
sku :
ARP65141
product type :
Polyclonal Antibody
category :
Polyclonal
name :
RPL15 antibody - N-terminal region (ARP65141_P050)
size :
100 ul
gene symbol :
RPL15
alias symbols :
EC45, FLJ26304, MGC88603, RPL10, RPLY10, RPYL10
nucleotide accession num :
NM_002948
protein accession num :
NP_002939
swissprot id :
P61313
species reactivity :
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRK
RPVPKGATYGK
Synthetic peptide located within the following region:
RPVPKGATYGK
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 4S subunit and a large 6S subunit. Together these subunits are composed of 4 RNA species and approximately 8 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 6S subunit. The protein belongs to the L15E family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with the yeast ribosomal protein YL1 gene. Although this gene has been referred to as RPL1, its official symbol is RPL15. This gene has been shown to be overexpressed in some esophageal tumors compared to normal matched tissues. Alternate splicing results in multiple transcript variants. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
host :
Rabbit
application :
WB
homology :
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
purification :
Affinity Purified
clonality :
Polyclonal
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments