RPL15 antibody - N-terminal region (ARP65141_P050) | Aviva Systems Biology ARP65141 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

RPL15 antibody - N-terminal region (ARP65141_P050)

catalog :

ARP65141

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP65141

product type :

Polyclonal Antibody

category :

Polyclonal

name :

RPL15 antibody - N-terminal region (ARP65141_P050)

size :

100 ul

gene symbol :

RPL15

alias symbols :

EC45, FLJ26304, MGC88603, RPL10, RPLY10, RPYL10

nucleotide accession num :

NM_002948

protein accession num :

NP_002939

swissprot id :

P61313

species reactivity :

Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRK
RPVPKGATYGK
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 4S subunit and a large 6S subunit. Together these subunits are composed of 4 RNA species and approximately 8 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 6S subunit. The protein belongs to the L15E family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with the yeast ribosomal protein YL1 gene. Although this gene has been referred to as RPL1, its official symbol is RPL15. This gene has been shown to be overexpressed in some esophageal tumors compared to normal matched tissues. Alternate splicing results in multiple transcript variants. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%

purification :

Affinity Purified

clonality :

Polyclonal

drywet surcharge :

Wet Ice

storage temperature :

-20C