FLNC Antibody - N-terminal region (ARP64454_P050) | Aviva Systems Biology ARP64454 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

FLNC Antibody - N-terminal region (ARP64454_P050)

catalog :

ARP64454

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP64454

product type :

Polyclonal Antibody

category :

Polyclonal

name :

FLNC Antibody - N-terminal region (ARP64454_P050)

size :

100 ul

gene symbol :

FLNC

alias symbols :

ABP-280, ABP280A, ABPA, ABPL, FLJ10186, FLN2

nucleotide accession num :

NM_001127487

protein accession num :

NP_001120959

swissprot id :

Q14315

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

VGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDG
SCDVRYWPTEP
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FLNC

drywet surcharge :

Wet Ice

storage temperature :

-20C