RPS2 antibody - middle region (ARP63572_P050) | Aviva Systems Biology ARP63572 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

RPS2 antibody - middle region (ARP63572_P050)

catalog :

ARP63572

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat, dogs, zebrafish

application :

western blot

product information

sku :

ARP63572

product type :

Polyclonal Antibody

category :

Polyclonal

name :

RPS2 antibody - middle region (ARP63572_P050)

size :

100 ul

gene symbol :

RPS2

alias symbols :

LLREP3, MGC102851, MGC117344, MGC117345, S2

nucleotide accession num :

NM_002952

protein accession num :

NP_002943

swissprot id :

P15880

species reactivity :

Dog, Pig, Rat, Yeast, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

GASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHV
GLGVKCSKEVA
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 4S subunit and a large 6S subunit. Together these subunits are composed of 4 RNA species and approximately 8 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 4S subunit. The protein belongs to the S5P family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with mouse LLRep3. It is co-transcribed with the small nucleolar RNA gene U64, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

host :

Rabbit

application :

homology :

Dog: 100%; Pig: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%

purification :

Affinity Purified

clonality :

Polyclonal

drywet surcharge :

Wet Ice

storage temperature :

-20C