MRPL45 antibody - C-terminal region (ARP60476_P050) | Aviva Systems Biology ARP60476 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

MRPL45 antibody - C-terminal region (ARP60476_P050)

catalog :

ARP60476

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, bovine, zebrafish

application :

western blot

product information

sku :

ARP60476

product type :

Polyclonal Antibody

category :

Polyclonal

name :

MRPL45 antibody - C-terminal region (ARP60476_P050)

size :

100 ul

gene symbol :

MRPL45

alias symbols :

MGC11321, L45mt, MRP-L45

nucleotide accession num :

NM_032351

protein accession num :

NP_115727

swissprot id :

Q9BRJ2

species reactivity :

Cow, Human, Mouse, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

YGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPEEEYE
EAQGEAQKPQL
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 2p and 17q.

host :

Rabbit

application :

homology :

Cow: 75%; Human: 100%; Mouse: 91%; Rat: 82%; Zebrafish: 75%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human MRPL45

drywet surcharge :

Wet Ice

storage temperature :

-20C