USP7 antibody - middle region (ARP59057_P050) | Aviva Systems Biology ARP59057 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

USP7 antibody - middle region (ARP59057_P050)

catalog :

ARP59057

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP59057

product type :

Polyclonal Antibody

category :

Polyclonal

name :

USP7 antibody - middle region (ARP59057_P050)

size :

100 ul

gene symbol :

USP7

alias symbols :

HAUSP, TEF1

nucleotide accession num :

NM_003470

protein accession num :

NP_003461

swissprot id :

Q93009

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

RVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDY
RSDRREDYYDI
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

USP7 is a hydrolase that deubiquitinates target proteins such as FOXO4, TP53, MDM2, PTEN and DAXX. Together with DAXX, USP7 prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards TP53, thereby promoting TP53 ubiquitination and proteasomal degradation. USP7 deubiquitinates TP53 and MDM2 and strongly stabilizes TP53 even in the presence of excess MDM2, and also induces TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, USP7 is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. USP7 is involved in cell proliferation during early embryonic development. USP7 contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP/VMW11 during HSV-1 infection.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human USP7

drywet surcharge :

Wet Ice

storage temperature :

-20C