This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
PDGFD antibody - N-terminal region (ARP58814_P050)
catalog :
ARP58814
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
sku :
ARP58814
product type :
Polyclonal Antibody
category :
Polyclonal
name :
PDGFD antibody - N-terminal region (ARP58814_P050)
size :
100 ul
gene symbol :
PDGFD
alias symbols :
IEGF, MGC26867, MSTP036, SCDGF-B, SCDGFB
nucleotide accession num :
NM_025208
protein accession num :
NP_079484
swissprot id :
Q9GZP0
species reactivity :
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSY
PRNLLLTWRLH
Synthetic peptide located within the following region:
PRNLLLTWRLH
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are f
host :
Rabbit
application :
WB
homology :
Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFD
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
