ARPC2 antibody - N-terminal region (ARP58587_P050) | Aviva Systems Biology ARP58587 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

ARPC2 antibody - N-terminal region (ARP58587_P050)

catalog :

ARP58587

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, bovine

application :

western blot

product information

sku :

ARP58587

product type :

Polyclonal Antibody

category :

Polyclonal

name :

ARPC2 antibody - N-terminal region (ARP58587_P050)

size :

100 ul

gene symbol :

ARPC2

alias symbols :

ARC34, PNAS-139, PRO2446, p34-Arc

nucleotide accession num :

NM_005731

protein accession num :

NP_005722

swissprot id :

O15144

species reactivity :

Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHV
QTFLFVVFFCL
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

ARPC2 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of ARPC2, the p34 subunit, has yet to be determined. This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.

host :

Rabbit

application :

homology :

Cow: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human ARPC2

drywet surcharge :

Wet Ice

storage temperature :

-20C