This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
DAPK1 antibody - N-terminal region (ARP58219_P050)
catalog :
ARP58219
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs
application :
western blot
product information
sku :
ARP58219
product type :
Polyclonal Antibody
category :
Polyclonal
name :
DAPK1 antibody - N-terminal region (ARP58219_P050)
size :
100 ul
gene symbol :
DAPK1
alias symbols :
DAPK, DKFZp781I035
nucleotide accession num :
NM_004938
protein accession num :
NP_004929
swissprot id :
P53355
species reactivity :
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQY
AAKFIKKRRTK
Synthetic peptide located within the following region:
AAKFIKKRRTK
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 16-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen
host :
Rabbit
application :
WB
homology :
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the N terminal region of human DAPK1
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
