NKX3-2 antibody - middle region (ARP58064_P050) | Aviva Systems Biology ARP58064 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

NKX3-2 antibody - middle region (ARP58064_P050)

catalog :

ARP58064

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, dogs, bovine

application :

western blot

product information

sku :

ARP58064

product type :

Polyclonal Antibody

category :

Polyclonal

name :

NKX3-2 antibody - middle region (ARP58064_P050)

size :

100 ul

gene symbol :

NKX3-2

alias symbols :

BAPX1, MGC138171, NKX3.2, NKX3B, SMMD

nucleotide accession num :

NM_001189

protein accession num :

NP_001180

swissprot id :

P78367

species reactivity :

Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

GAGGGGGSGPAGVAEEEEEPAAPKPRKKRSRAAFSHAQV
FELERRFNHQR
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

NKX3-2 is a member of the NK family of homeobox-containing proteins. It may play a role in skeletal development.This gene encodes a member of the NK family of homeobox-containing proteins. The encoded protein may play a role in skeletal development. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1111 BC111966.1 1-1111 1112-2241 AC6445.11 11916-11245

host :

Rabbit

application :

homology :

Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human NKX3-2

drywet surcharge :

Wet Ice

storage temperature :

-20C