MATN2 antibody - middle region (ARP57667_P050) | Aviva Systems Biology ARP57667 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

MATN2 antibody - middle region (ARP57667_P050)

catalog :

ARP57667

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP57667

product type :

Polyclonal Antibody

category :

Polyclonal

name :

MATN2 antibody - middle region (ARP57667_P050)

size :

100 ul

gene symbol :

MATN2

alias symbols :

nucleotide accession num :

NM_030583

protein accession num :

NP_085072

swissprot id :

A8K106

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEK
LKKGICEALED
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.This gene encodes a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene.

host :

Rabbit

application :

homology :

Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 82%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human MATN2

drywet surcharge :

Wet Ice

storage temperature :

-20C