FBXW8 antibody - middle region (ARP55585_P050) | Aviva Systems Biology ARP55585 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

FBXW8 antibody - middle region (ARP55585_P050)

catalog :

ARP55585

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP55585

product type :

Polyclonal Antibody

category :

Polyclonal

name :

FBXW8 antibody - middle region (ARP55585_P050)

size :

100 ul

gene symbol :

FBXW8

alias symbols :

FBW6, FBW8, FBX29, FBXO29, MGC33534, FBXW6

nucleotide accession num :

NM_153348

protein accession num :

NP_699179

swissprot id :

Q8N3Y1

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNAD
LDSFTTHRRHR
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

FBXW8 is a member of the F-box protein family, members of which are characterized by an approximately 4 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-4 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXW8 contains a WD-4 domain, in addition to an F-box motif, so it belongs to the Fbw class.This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 4 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-4 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene contains a WD-4 domain, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

host :

Rabbit

application :

homology :

Cow: 83%; Dog: 92%; Guinea Pig: 83%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human FBXW8

drywet surcharge :

Wet Ice

storage temperature :

-20C