LGALS3BP Antibody - middle region (ARP54779_P050) | Aviva Systems Biology ARP54779 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

LGALS3BP Antibody - middle region (ARP54779_P050)

catalog :

ARP54779

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP54779

product type :

Polyclonal Antibody

category :

Polyclonal

name :

LGALS3BP Antibody - middle region (ARP54779_P050)

size :

100 ul

gene symbol :

LGALS3BP

alias symbols :

90K, M2BP, gp90, CyCAP, BTBD17B, MAC-2-BP, TANGO10B

nucleotide accession num :

NM_005567

protein accession num :

NP_005558

swissprot id :

Q08380

species reactivity :

Cow, Dog, Human, Mouse, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLT
EDTYKPRIYTS
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 9K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.

host :

Rabbit

application :

homology :

Cow: 83%; Dog: 83%; Human: 100%; Mouse: 100%; Rat: 86%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human LGALS3BP

drywet surcharge :

Wet Ice

storage temperature :

-20C