This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
FAU antibody - middle region (ARP54604_P050)
catalog :
ARP54604
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine, zebrafish
application :
western blot, immunohistochemistry
product information
sku :
ARP54604
product type :
Polyclonal Antibody
category :
Polyclonal
name :
FAU antibody - middle region (ARP54604_P050)
size :
100 ul
gene symbol :
FAU
alias symbols :
FAU1, FLJ22986, Fub1, Fubi, MNSFbeta, RPS30, S30, asr1
nucleotide accession num :
NM_001997
protein accession num :
NP_001988
swissprot id :
P62861
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFG
KKKGPNANS
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S3 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S3. Fubi is a member of the ubiquitin family, and ribosomal protein S3 belongs to the S3E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S3 is a component of the 4S subunit of the cytoplasmic ribosome.This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S3 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S3. Fubi is a member of the ubiquitin family, and ribosomal protein S3 belongs to the S3E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S3 is a component of the 4S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S3, ribosomal proteins S27a and L4 are synthesized as fusion proteins with ubiquitin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
host :
Rabbit
application :
WB, IHC
homology :
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human FAU
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com
1-858-552-6979
headquarters: United States