FAU antibody - middle region (ARP54604_P050) | Aviva Systems Biology ARP54604 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

FAU antibody - middle region (ARP54604_P050)

catalog :

ARP54604

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot, immunohistochemistry

product information

sku :

ARP54604

product type :

Polyclonal Antibody

category :

Polyclonal

name :

FAU antibody - middle region (ARP54604_P050)

size :

100 ul

gene symbol :

FAU

alias symbols :

FAU1, FLJ22986, Fub1, Fubi, MNSFbeta, RPS30, S30, asr1

nucleotide accession num :

NM_001997

protein accession num :

NP_001988

swissprot id :

P62861

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFG
KKKGPNANS
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S3 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S3. Fubi is a member of the ubiquitin family, and ribosomal protein S3 belongs to the S3E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S3 is a component of the 4S subunit of the cytoplasmic ribosome.This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S3 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S3. Fubi is a member of the ubiquitin family, and ribosomal protein S3 belongs to the S3E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S3 is a component of the 4S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S3, ribosomal proteins S27a and L4 are synthesized as fusion proteins with ubiquitin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

WB, IHC

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human FAU

drywet surcharge :

Wet Ice

storage temperature :

-20C