ARF6 antibody - middle region (ARP54598_P050) | Aviva Systems Biology ARP54598 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

ARF6 antibody - middle region (ARP54598_P050)

catalog :

ARP54598

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot, immunohistochemistry

product information

sku :

ARP54598

product type :

Polyclonal Antibody

category :

Polyclonal

name :

ARF6 antibody - middle region (ARP54598_P050)

size :

100 ul

gene symbol :

ARF6

alias symbols :

DKFZp564M0264

nucleotide accession num :

NM_001663

protein accession num :

NP_001654

swissprot id :

P62330

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRN
WYVQPSCATSG
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human ARF6

drywet surcharge :

Wet Ice

storage temperature :

-20C