IL1A antibody - N-terminal region (ARP54322_P050) | Aviva Systems Biology ARP54322 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

IL1A antibody - N-terminal region (ARP54322_P050)

catalog :

ARP54322

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP54322

product type :

Polyclonal Antibody

category :

Polyclonal

name :

IL1A antibody - N-terminal region (ARP54322_P050)

size :

100 ul

gene symbol :

IL1A

alias symbols :

IL-1A, IL1, IL1-ALPHA, IL1F1

nucleotide accession num :

NM_000575

protein accession num :

NP_000566

swissprot id :

P01583

species reactivity :

Cow, Dog, Goat, Horse, Human, Mouse, Rat, Sheep

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVAT
NGKVLKKRRLS
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

The IL1A protein is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. The gene encoding IL1A and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

homology :

Cow: 92%; Dog: 85%; Goat: 85%; Horse: 93%; Human: 100%; Mouse: 79%; Rat: 79%; Sheep: 85%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human IL1A

drywet surcharge :

Wet Ice

storage temperature :

-20C