FBXO31 antibody - middle region (ARP53776_P050) | Aviva Systems Biology ARP53776 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

FBXO31 antibody - middle region (ARP53776_P050)

catalog :

ARP53776

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP53776

product type :

Polyclonal Antibody

category :

Polyclonal

name :

FBXO31 antibody - middle region (ARP53776_P050)

size :

100 ul

gene symbol :

FBXO31

alias symbols :

DKFZP434B027, DKFZp434J1815, FBX14, FBXO14, FLJ22477, Fbx31, MGC15419, MGC9527, pp2386

nucleotide accession num :

NM_024735

protein accession num :

NP_079011

swissprot id :

Q5XUX0

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

VAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYG
TGLIAGHGFTS
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

FBXO31 is the component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in G1 arrest following DNA damage. FBXO31 specifically recognizes phosphorylated cyclin-D1 (CCND1), promoting its ubiquitination and degradation by the proteasome, resulting in G1 arrest. FBXO31 may act as a tumor suppressor.Members of the F-box protein family, such as FBXO31, are characterized by an approximately 4-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 61434), cullin (see CUL1; MIM 63134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 24 [PubMed 1552277]).[supplied by OMIM].

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human FBXO31

drywet surcharge :

Wet Ice

storage temperature :

-20C