EGFLAM Antibody - C-terminal region (ARP53435_P050) | Aviva Systems Biology ARP53435 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

EGFLAM Antibody - C-terminal region (ARP53435_P050)

catalog :

ARP53435

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP53435

product type :

Polyclonal Antibody

category :

Polyclonal

name :

EGFLAM Antibody - C-terminal region (ARP53435_P050)

size :

100 ul

gene symbol :

EGFLAM

swissprot id :

Q63HQ2-3

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLG
SGVASIMVNGS
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

EGFLAM is involved in both the retinal photoreceptor ribbon synapse formation and physiological functions of visual perception. It is necessary for proper bipolar dendritic tip apposition to the photoreceptor ribbon synapse and promotes matrix assembly and cell adhesiveness.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EGFLAM

drywet surcharge :

Wet Ice

storage temperature :

-20C