ENDOG antibody - middle region (ARP52054_P050) | Aviva Systems Biology ARP52054 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

ENDOG antibody - middle region (ARP52054_P050)

catalog :

ARP52054

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP52054

product type :

Polyclonal Antibody

category :

Polyclonal

name :

ENDOG antibody - middle region (ARP52054_P050)

size :

100 ul

gene symbol :

ENDOG

alias symbols :

FLJ27463

nucleotide accession num :

NM_004435

protein accession num :

NP_004426

swissprot id :

Q14249

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILAR
AGSLKAITAGS
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.The protein encoded by this gene is a nuclear encoded endonuclease that is localized in the mitochondrion. The encoded protein is widely distributed among animals and cleaves DNA at GC tracts. This protein is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.

host :

Rabbit

application :

homology :

Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human ENDOG

drywet surcharge :

Wet Ice

storage temperature :

-20C