SERPINA3 antibody - middle region (ARP51880_P050) | Aviva Systems Biology ARP51880 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

SERPINA3 antibody - middle region (ARP51880_P050)

catalog :

ARP51880

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

sku :

ARP51880

product type :

Polyclonal Antibody

category :

Polyclonal

name :

SERPINA3 antibody - middle region (ARP51880_P050)

size :

100 ul

gene symbol :

SERPINA3

alias symbols :

AACT, ACT, GIG24, GIG25, MGC88254

nucleotide accession num :

NM_001085

protein accession num :

NP_001076

swissprot id :

P01011

species reactivity :

Human, Mouse, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

FRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLL
PETLKRWRDSL
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

SERPINA3 is a plasma protease inhibitor and member of the serine protease inhibitor class. Polymorphisms in this protein appear to be tissue specific and influence protease targeting. Variations in this protein's sequence have been implicated in Alzheimer's disease, and deficiency of this protein has been associated with liver disease.The protein encoded by this gene is a plasma protease inhibitor and member of the serine protease inhibitor class. Polymorphisms in this protein appear to be tissue specific and influence protease targeting. Variations in this protein's sequence have been implicated in Alzheimer's disease, and deficiency of this protein has been associated with liver disease. Mutations have been identified in patients with Parkinson disease and chronic obstructive pulmonary disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

homology :

Human: 100%; Mouse: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human SERPINA3

drywet surcharge :

Wet Ice

storage temperature :

-20C