ADA antibody - N-terminal region (ARP51757_P050) | Aviva Systems Biology ARP51757 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

ADA antibody - N-terminal region (ARP51757_P050)

catalog :

ARP51757

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP51757

product type :

Polyclonal Antibody

category :

Polyclonal

name :

ADA antibody - N-terminal region (ARP51757_P050)

size :

100 ul

gene symbol :

ADA

alias symbols :

nucleotide accession num :

NM_000022

protein accession num :

NP_000013

swissprot id :

P00813

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLAN
SKVEPIPWNQA
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human ADA

drywet surcharge :

Wet Ice

storage temperature :

-20C