MBNL2 antibody - middle region (ARP51632_P050) | Aviva Systems Biology ARP51632 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

MBNL2 antibody - middle region (ARP51632_P050)

catalog :

ARP51632

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP51632

product type :

Polyclonal Antibody

category :

Polyclonal

name :

MBNL2 antibody - middle region (ARP51632_P050)

size :

100 ul

gene symbol :

MBNL2

alias symbols :

DKFZp781H1296, MBLL, MBLL39, MGC120625, MGC120626, MGC120628, PRO2032, RP11-128N14.1

nucleotide accession num :

NM_005757

protein accession num :

NP_005748

swissprot id :

O95205

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

ENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGR
NNLIQQKTAAA
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

MBNL2 is a C3H-type zinc finger protein, which is similar to the Drosophila melanogaster muscleblind B protein.MBNL2 is a RNA-binding protein that binds to 5'ACACCC-3' core sequence. It binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. MBNL2 seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm. It may play a role in myotonic dystrophy pathophysiology (DM).

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human MBNL2

drywet surcharge :

Wet Ice

storage temperature :

-20C