OAS1 antibody - middle region (ARP51359_P050) | Aviva Systems Biology ARP51359 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

OAS1 antibody - middle region (ARP51359_P050)

catalog :

ARP51359

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP51359

product type :

Polyclonal Antibody

category :

Polyclonal

name :

OAS1 antibody - middle region (ARP51359_P050)

size :

100 ul

gene symbol :

OAS1

alias symbols :

IFI-4, OIAS, OIASI

nucleotide accession num :

NM_001032409

protein accession num :

NP_001027581

swissprot id :

P00973-3

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

RRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAW
LNYPCFKNWDG
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 93%; Dog: 93%; Guinea Pig: 87%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human OAS1

application info :

IHC - Paraffin ~~ 5 ug/ml Western blot ~~1 ug/ml

drywet surcharge :

Wet Ice

storage temperature :

-20C