RHBDF1 antibody - N-terminal region (ARP49721_P050) | Aviva Systems Biology ARP49721 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

RHBDF1 antibody - N-terminal region (ARP49721_P050)

catalog :

ARP49721

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP49721

product type :

Polyclonal Antibody

category :

Polyclonal

name :

RHBDF1 antibody - N-terminal region (ARP49721_P050)

size :

100 ul

gene symbol :

RHBDF1

alias symbols :

C16orf8, Dist1, EGFR-RS, FLJ2235, FLJ22357, gene -89, gene -90, hDist1, gene-89, gene-90

nucleotide accession num :

NM_022450

protein accession num :

NP_071895

swissprot id :

Q96CC6

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQK
EGAAAPQPKVR
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human RHBDF1

drywet surcharge :

Wet Ice

storage temperature :

-20C