This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
RHBG antibody - N-terminal region (ARP49502_P050)
catalog :
ARP49502
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine, zebrafish
application :
western blot
product information
sku :
ARP49502
product type :
Polyclonal Antibody
category :
Polyclonal
name :
RHBG antibody - N-terminal region (ARP49502_P050)
size :
100 ul
gene symbol :
RHBG
alias symbols :
SLC42A2
nucleotide accession num :
NM_020407
protein accession num :
NP_065140
swissprot id :
Q9H310
species reactivity :
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFV
GFGFLMVFLQR
Synthetic peptide located within the following region:
GFGFLMVFLQR
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
RHBG and RHCG are non-erythroid members of the Rhesus (Rh) protein family that are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. Rh family proteins are all predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini.
host :
Rabbit
application :
WB
homology :
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Sheep: 80%; Zebrafish: 82%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the N terminal region of human RHBG
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
