SULT1A1 antibody - N-terminal region (ARP49134_P050) | Aviva Systems Biology ARP49134 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

SULT1A1 antibody - N-terminal region (ARP49134_P050)

catalog :

ARP49134

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, zebrafish

application :

western blot, immunohistochemistry

product information

sku :

ARP49134

product type :

Polyclonal Antibody

category :

Polyclonal

name :

SULT1A1 antibody - N-terminal region (ARP49134_P050)

size :

100 ul

gene symbol :

SULT1A1

alias symbols :

HAST1/HAST2, MGC131921, MGC5163, P-PST, PST, ST1A3, STP, STP1, TSPST1, ST1A1

nucleotide accession num :

NM_001055

protein accession num :

NP_001046

swissprot id :

P50226

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDD
LLISTYPKSGT
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene.

host :

Rabbit

application :

WB, IHC

homology :

Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 86%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human SULT1A1

drywet surcharge :

Wet Ice

storage temperature :

-20C