CDYL antibody - N-terminal region (ARP49096_P050) | Aviva Systems Biology ARP49096 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

CDYL antibody - N-terminal region (ARP49096_P050)

catalog :

ARP49096

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot, immunocytochemistry

product information

sku :

ARP49096

product type :

Polyclonal Antibody

category :

Polyclonal

name :

CDYL antibody - N-terminal region (ARP49096_P050)

size :

100 ul

gene symbol :

CDYL

alias symbols :

CDYL1, DKFZP586C1622, MGC131936

nucleotide accession num :

NM_004824

protein accession num :

NP_004815

swissprot id :

Q9Y232

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNS
NFSKTSPKALV
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene.

host :

Rabbit

application :

IF, WB

homology :

Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 86%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the n terminal region of human CDYL

drywet surcharge :

Wet Ice

storage temperature :

-20C