This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
CHST14 antibody - middle region (ARP48994_P050)
catalog :
ARP48994
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot
product information
sku :
ARP48994
product type :
Polyclonal Antibody
category :
Polyclonal
name :
CHST14 antibody - middle region (ARP48994_P050)
size :
100 ul
gene symbol :
CHST14
alias symbols :
D4ST-1, D4ST1, HD4ST, HNK1ST, ATCS
nucleotide accession num :
Q8NCH0
protein accession num :
AAH23653
swissprot id :
Q8NCH0
species reactivity :
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVD
EDPERMNEHWM
Synthetic peptide located within the following region:
EDPERMNEHWM
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.
host :
Rabbit
application :
WB
homology :
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human CHST14
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
