IL28RA antibody - N-terminal region (ARP48069_P050) | Aviva Systems Biology ARP48069 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

IL28RA antibody - N-terminal region (ARP48069_P050)

catalog :

ARP48069

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP48069

product type :

Polyclonal Antibody

category :

Polyclonal

name :

IL28RA antibody - N-terminal region (ARP48069_P050)

size :

100 ul

gene symbol :

IFNLR1

alias symbols :

CRF2/12, IFNLR, IFNLR1, LICR2, il-28r1, IL-28R1, IL28RA

nucleotide accession num :

NM_173064

protein accession num :

NP_775087

swissprot id :

Q5VTX8

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSP
WVESEYLDYLF
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 1 receptor, beta (IL1RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 1 receptor, beta (IL1RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.

host :

Rabbit

application :

homology :

Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 77%; Rabbit: 86%; Rat: 92%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human IL28RA

drywet surcharge :

Wet Ice

storage temperature :

-20C