KRT19 antibody - N-terminal region (ARP47464_P050) | Aviva Systems Biology ARP47464 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

KRT19 antibody - N-terminal region (ARP47464_P050)

catalog :

ARP47464

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP47464

product type :

Polyclonal Antibody

category :

Polyclonal

name :

KRT19 antibody - N-terminal region (ARP47464_P050)

size :

100 ul

gene symbol :

KRT19

alias symbols :

CK19, K19, K1CS, MGC15366

nucleotide accession num :

NM_002276

protein accession num :

NP_002267

swissprot id :

P08727

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

TSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGS
GGRGVSVSSAR
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

KRT19 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis.The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

WB, IHC

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human KRT19

drywet surcharge :

Wet Ice

storage temperature :

-20C