COQ2 antibody - middle region (ARP47180_P050) | Aviva Systems Biology ARP47180 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

COQ2 antibody - middle region (ARP47180_P050)

catalog :

ARP47180

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, zebrafish

application :

western blot

product information

sku :

ARP47180

product type :

Polyclonal Antibody

category :

Polyclonal

name :

COQ2 antibody - middle region (ARP47180_P050)

size :

100 ul

gene symbol :

COQ2

alias symbols :

CL640, FLJ26072

nucleotide accession num :

NM_015697

protein accession num :

NP_056512

swissprot id :

Q96H96

species reactivity :

Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTK
PWLSGFSVAML
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 24 [PubMed 1515369]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-9 BC2728.1 1-9 91-96 BG699931.1 8-85 97-789 BC2728.1 97-789 79-792 BQ363759.1 169-171 793-1535 BC2728.1 793-1535 1536-1554 BC884.2 1496-1514

host :

Rabbit

application :

homology :

Dog: 93%; Goat: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86%; Yeast: 91%; Zebrafish: 86%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human COQ2

drywet surcharge :

Wet Ice

storage temperature :

-20C