FJX1 antibody - N-terminal region (ARP47013_P050) | Aviva Systems Biology ARP47013 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

FJX1 antibody - N-terminal region (ARP47013_P050)

catalog :

ARP47013

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs

application :

western blot

product information

sku :

ARP47013

product type :

Polyclonal Antibody

category :

Polyclonal

name :

FJX1 antibody - N-terminal region (ARP47013_P050)

size :

100 ul

gene symbol :

FJX1

alias symbols :

FLJ22416, FLJ25593

nucleotide accession num :

NM_014344

protein accession num :

NP_055159

swissprot id :

Q86VR8

species reactivity :

Dog, Guinea Pig, Human, Mouse, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGE
ALSYYLARLLG
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

FJX1 is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of FJX1 gene in humans is not known. The protein encoded by this gene is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of this gene in humans is not known.

host :

Rabbit

application :

homology :

Dog: 79%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human FJX1

drywet surcharge :

Wet Ice

storage temperature :

-20C