BACE1 antibody - N-terminal region (ARP46851_P050) | Aviva Systems Biology ARP46851 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

BACE1 antibody - N-terminal region (ARP46851_P050)

catalog :

ARP46851

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot, immunohistochemistry, immunocytochemistry

product information

sku :

ARP46851

product type :

Polyclonal Antibody

category :

Polyclonal

name :

BACE1 antibody - N-terminal region (ARP46851_P050)

size :

100 ul

gene symbol :

BACE1

alias symbols :

ASP2, BACE, FLJ90568, HSPC104, KIAA1149

nucleotide accession num :

NM_012104

protein accession num :

NP_036236

swissprot id :

P56817

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLH
RYYQRQLSSTY
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein encoded by this gene. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. Four transcript variants encoding different isoforms have been described for this gene.

host :

Rabbit

application :

IHC, WB, IF

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human BACE1

drywet surcharge :

Wet Ice

storage temperature :

-20C